PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID cra_locus_930_iso_2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Apocynaceae; Rauvolfioideae; Vinceae; Catharanthinae; Catharanthus
Family TALE
Protein Properties Length: 650aa    MW: 72798.4 Da    PI: 6.8659
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
cra_locus_930_iso_2genomeMPGR-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox277.4e-094234601954
                                         HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
                            Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                                         Fe   ++yps  ++  LA+++gL+ +qV++WF N R +
  cra_locus_930_iso_2_len_2196_ver_3 423 FEHflHPYPSDVDKHILARQTGLSRSQVSNWFINARVR 460
                                         554459******************************88 PP

2BELL112.91.7e-36281349472
                                BELL   4 elqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                                         elqk+k+kLl++leeVd+rYk+y++q++ v+ sFe+vag g+ak+Y +lA+ka+SrhFrcL+d i++q+
  cra_locus_930_iso_2_len_2196_ver_3 281 ELQKRKSKLLQMLEEVDRRYKHYCNQMRSVVCSFEEVAGNGAAKVYSALASKAMSRHFRCLRDGIVGQV 349
                                         89****************************************************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005749.1E-52222347IPR006563POX domain
PfamPF075261.5E-43228345IPR006563POX domain
PROSITE profilePS5007112.115401464IPR001356Homeobox domain
SMARTSM003892.5E-9404468IPR001356Homeobox domain
CDDcd000863.60E-11404465No hitNo description
SuperFamilySSF466894.71E-17405471IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.607.5E-28407470IPR009057Homeodomain-like
PfamPF059208.7E-18421460IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0048481Biological Processplant ovule development
GO:0005634Cellular Componentnucleus
GO:0005829Cellular Componentcytosol
GO:0009506Cellular Componentplasmodesma
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 650 aa     Download sequence    Send to blast
FKYFAGDDVL RYNLRFRQQK LFSMPSPGGG EEEKTTRSTM VMTTGYNFSD VSTAANNPNN  60
MVSQFQTFDS NTHQEIYGLD MIGFSSKNNN LHHHQPPSTH HDSSSSVMWK EFFGKSGDGP  120
SSSSSKTTIN HHHQPSDGFY HHHHQPPPDF STTGGGVSEA AGWTHHDPCV FPCEGNDQSR  180
PISSTHQGLS LTLGNTSNNL QIFQQEGLFG KLSAAAQYHH HHHGQFEIRS SKYLNPAQEL  240
LNEFCCLDTK QNSQKTHNPQ WHEDQENATK FQSLYSLDLL ELQKRKSKLL QMLEEVDRRY  300
KHYCNQMRSV VCSFEEVAGN GAAKVYSALA SKAMSRHFRC LRDGIVGQVK AIKKALGEKD  360
HHTSTSSVAP GTTRGETPRL RLLDQTLRQQ RAFQQMNMME SHPWRPQRGL PERAVSVLRA  420
WLFEHFLHPY PSDVDKHILA RQTGLSRSQV SNWFINARVR LWKPMVEEMY LEENKEQENI  480
GSSDGTNSLD EINVSRHNHH QDDQKPTADQ LVRIDSECLS SIINNPEKND TTTSKNQLQD  540
QELQGTFGRV TDTFGAIELD FSSYNQNLVG GSGGGGSVSL TLGLQQHGGG GGGGVSLAFS  600
SAASQNSLFY GREHIEDCPP SVQYSLLDNE GQNLPYRNLM GAQLLHDLAG
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4xrm_A4e-16410468563Homeobox protein Meis2
4xrm_B4e-16410468563Homeobox protein Meis2
4xrs_A4e-16410467158Homeobox protein Meis1
4xrs_B4e-16410467158Homeobox protein Meis1
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006439494.10.0hypothetical protein CICLE_v10019130mg
RefseqXP_006476516.10.0PREDICTED: homeobox protein BEL1 homolog
SwissprotQ388971e-142BEL1_ARATH; Homeobox protein BEL1 homolog
TrEMBLF6HUM60.0F6HUM6_VITVI; Putative uncharacterized protein
STRINGVIT_02s0025g00200.t010.0(Vitis vinifera)